PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009774508.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 321aa    MW: 37121.6 Da    PI: 8.6222
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009774508.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF40.24.5e-131152344
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                    i+ +  r+ tf kR+ g++KK +E  +LC+++ ++i++++++
  XP_009774508.1 11 ISKEKGRNATFKKRKDGLMKKLYEFTTLCNVNGCMIMYGPKQ 52
                    7888899********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.7E-16160IPR002100Transcription factor, MADS-box
SMARTSM004321.5E-13165IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.175151IPR002100Transcription factor, MADS-box
CDDcd002668.75E-18295No hitNo description
PRINTSPR004045.7E-7323IPR002100Transcription factor, MADS-box
PfamPF003194.8E-141152IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-72338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MGRAKLKMEL ISKEKGRNAT FKKRKDGLMK KLYEFTTLCN VNGCMIMYGP KQSNGSNSEP  60
EIWTNNSMQS GNSTNKTVQV EEIQNLIDEY KKESSMQSGS TKTFGLSDYF LDRNKKVEEE  120
LIKLRKMNMQ KKYPCWLEFM NQLSEIKLRE FLTLLDDKVE KVKSRIDLLK GNFSSEGLSQ  180
LTHYNDNVNP LLVQGGMEHG GNFMNNNQEQ GAIYPYCSSI INHQEMMMLM MNENDWQYNG  240
ASSSSSSNGN NNMRCALMKY ETMMSHNMML NNQMTYSPYV APTILQPAPY MMMPSALPQM  300
YHPTKENERD EKLKLSPYLR Q
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009774508.10.0PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLM1CBS41e-151M1CBS4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000641201e-151(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24572253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.14e-19M-type_MADS family protein